GTx1-15 is a toxin from the Chilean tarantula venom that acts as both a voltage-gated calcium channel blocker and a voltage-gated sodium channel blocker.
GTx1-15 is derived from the Chilean tarantula species Grammostola rosea and Phrixotrichus scrofa.[1][2][3]
GTx1-15 is composed of 34 amino acid residues; its sequence has been determined to be DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCQYVF. This peptide has a molecular weight of approximately 4 kDa and is amidated at its carboxy terminus.[3]
GTx1-15 belongs to the GTx1 family, which consists of long loop inhibitor cystine knot (ICK) motif toxins.[2] The GTx1-15 peptide has a conserved structure of six cysteine residues with the characteristic ICK motif,[1] which results in proteolytic, thermal, and chemical stability.[4]
GTx1-15 displays sequence homology with other ion channel toxins from several spider species. It is homologous in sequence with sodium channel blocker PaurTx3 by 76.5%, and it also shares similarities in sequence with HnTx-IV (60%), CcoTx2 (55.9%), TLTx1 (55.6%), ω-GrTx SIA (40%), GsAFII (38.2%) and GsMTx2 (38.2%).[1]
GTx1-15 targets low-voltage activated cation channels.[1] It specifically inhibits:
The mode of action of GTx1-15 has not yet been clarified.[1]
The effectiveness of GTx1-15 as a blocker of human cloned Nav and Cav channels is summarized below:[3]
Channels | IC50 |
---|---|
Cav3.1 | 0.01 μM |
Nav1.7 | 0.007 μM |
Nav1.3 | 0.12 ± 0.06 μM |
Nav1.5 | No significant effect (up to 2 μΜ) |
Nav1.8 | No significant effect (0.93 μM) |